Multiple Sequence Alignment:
PGRMC1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
PGRMC1 human MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVrGDQPAAsGDsDDDEPPPLPRLKRRDFtPAELrRFDGVQDPRILMAINGkVFDVtkGRkFyGPEGPyGVFAGrDASRGLATFCLDkEALkDEyDDLsDLtAAQQEtLsDWESQFTFkyHHVGkLLkEGEEPtVysDEEEPkDEsARKND
PGRMC1 mouse MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGAsGDNDDDEPPPLPRLKRRDFtPAELRRFDGVQDPRILMAINGkVFDVTkGRkFYGPEGPYGVFAGRDASRGLATFCLDkEALkDEyDDLSDLTPAQQETLSDWDSQFTFkYHHVGkLLkEGEEPtVysDDEEPKDEtARKNE
PGRMC1 rat MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFtPAELRRYDGVQDPRILMAINGKVFDVTkGRkFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGkLLkEGEEPtVysDDEEPKDEAARKsD
PGRMC1 pig MAAEDVAATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAAS-DSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYsDEEEPKDESARKND
  ******:*******:**:****:****************************:**:*:************:**********:*****************************************************************:******:**:*************************:******:***::
Consensus MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDESARKND
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.