Multiple Sequence Alignment:
RAP1B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
RAP1B human
RAP1B mouse
RAP1B rat
RAP1B cow
  ******************************************************************************************************************************************:*********************************************
Consensus MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.