Multiple Sequence Alignment:
FCER1G Download MSA
  (        10        20        30        40        50        60        70        80      )
           |         |         |         |         |         |         |         |      
FCER1G human MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSyEksDGVytGLstRNQEtyEtLKHEKPPQ
FCER1G mouse MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREkADAVytGLNTRsQETyEtLkHEkPPQ
FCER1G rat MIPAVILFLLLLVEEAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKsDAVYTGLNTRNQETYETLKHEKPPQ
  **:**:*:******:***************:**********************:*:*:**:*:*****:**:**************
Consensus MIPAVILFLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASREKSDAVYTGLNTRNQETYETLKHEKPPQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.