Multiple Sequence Alignment:
MGP Download MSA
  (        10        20        30        40        50        60        70        80        90       100    )
           |         |         |         |         |         |         |         |         |         |    
MGP human MKSLILLAILAALAVVTLCYEsHEsMEsYELNPFINRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERyAMVYGYNAAyNRYFRKRRGTK-
MGP iso2 human
MGP mouse MKSLLPLAILAALAVATLCYESHESMESYEISPFINRRNANTFMSPQQRWRAKAQKRVQERNKPAYEINREACDDYKLCERYAMVYGYNAAYNRYFRQRRGAKY
MGP rat MKSLLPLAILAALAVAALCYEsHEsMEsYEVSPFTTRRNANTFISPQQRWHAKAQERVRELNKPAQEINREACDDYKLCERYALIYGYNAAYNRYFRQRRGAK-
MGP cow MKSLLLLSILAALAVAALCYEsHEsLEsYEINPFINRRNANSFISPQQRWRAKAQERIRELNKPQYELNREACDDFKLCERYAMVYGYNAAYDRYFRQRRGAK-
  ****::*:*******::********:****::**::*****:*:******:**:*:*::*::**:.*:*******::******::*******:****:***:* 
Consensus MKSLLLLAILAALAVAALCYESHESMESYEINPFINRRNANTFISPQQRWRAKAQERIRERNKPAYEINREACDDYKLCERYAMVYGYNAAYNRYFRQRRGAK-
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.