Multiple Sequence Alignment:
ARPP-19 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110  )
           |         |         |         |         |         |         |         |         |         |         |  
ARPP-19 human MsAEVPEAAsAEEQKEMEDKVtsPEkAEEAkLkAryPHLGQkPGGsDFLRKRLQkGQkyFDsGDyNMAkAkMKNKQLPtAAPDkTEVTGDHIPtPQDLPQRkPsLVAskLAG
ARPP-19 iso2 human ----------------MEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDsGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
ARPP-19 mouse MsAEVPEAAsAEEQKEMEDKVtsPEKAEEAKLKARyPHLGQKPGGSDFLRKRLQKGQkyFDsGDyNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPsLVAsKLAG
ARPP-19 rat MsAEVPEAASAEEQKEMEDkVTSPEKAEEAkLKARYPHLGQkPGGSDFLRKRLQKGQkyFDsGDyNMAkAKMKNKQLPAAAPDkTEVTGDHIPTPQDLPQRKPsLVASkLAG
  ::::::::::::::::**************************************************************:*********************************
Consensus MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPAAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.