Multiple Sequence Alignment:
PDZD11 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
PDZD11 human -------------------------------MDSRIPyDDyPVVFLPAyENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIrGGKAsQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSkAVEILkTAREISMRVRFFPYNYHRQKERTVH
PDZD11 iso2 human MGWSCCLKLAGLLSLLNHFLSVLIHSSRALPEDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
PDZD11 mouse -------------------------------MDNRIPYDDyPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLkKPPGAQLGFNIrGGKAsQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSkAVEILKTAREISMRVRFFPYNYHRQKERTVH
PDZD11 rat -------------------------------MDNRIPYDDyPVVFLPAYENPPAWIPPHERVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
                                 :*:****************************:**************::********************************************************************************************
Consensus -------------------------------MDNRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRIITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.