Multiple Sequence Alignment:
VAMP2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110      )
           |         |         |         |         |         |         |         |         |         |         |      
VAMP2 human MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDkVLERDQkLsELDDrAdALQAGAsQFEtsAAkLkRKYWWkNLKMMIILGVICAIILIIIIVYFST
VAMP2 mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQtQAQVDEVVDIMRVNVDkVLERDQkLsELDDRADALQAGAsQFEtsAAkLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
VAMP2 rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDkVLERDQkLsELDDRADALQAGAsQFETSAAKLkRKYWWKNLKMMIILGVICAIILIIIIVYFST
  *******:************************************************************************************************************
Consensus MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.