Multiple Sequence Alignment:
PLM Download MSA
  (        10        20        30        40        50        60        70        80        90  )
           |         |         |         |         |         |         |         |         |  
PLM human MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGtFRssIRRLstRRR
PLM mouse MASPGHILALCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGtFRssIRRLssRRR
PLM rat MASPGHILIVCVCLLSMASAEAPQEPDPFTYDYHTLRIGGLTIAGILFILGILIILSKRCRCKFNQQQRTGEPDEEEGtFRSsIRRLstRRR
PLM dog MAPLHHILVLCVGFLTTATAEAPQEHDPFTYDYQSLRIGGLIIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSsIRRLstRRR
  **:::***:.**::*::*.**:*:*:*******::*:****.************:**:******************************:***
Consensus MASLGHILVLCVCLLSMASAEAPQEHDPFTYDYQSLRIGGLTIAGILFILGILIILSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.