Multiple Sequence Alignment:
gastrin Download MSA
  (        10        20        30        40        50        60        70        80        90       100    )
           |         |         |         |         |         |         |         |         |         |    
gastrin human MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRsAEDEN---
gastrin mouse MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDFGRRSAEE-DQ--
gastrin rat MPRLCVCMLVLVLALATFSEASWKPRSQLQDASSGPRTNGALEQHQLEKLGPASHHRRQLGPQGPQHFIADLSKKQRPPMEEEEEAYGWMDFGRRsAEEEDQYN
  *:****::*:::****:***********::**::*:::*.:**:.:::::*:*********:***:*::**:***::*.:******************::::..
Consensus MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNRDLEQRQLEKLGPASHHRRQLGPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEEDQ--
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.