Multiple Sequence Alignment:
ID2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130    )
           |         |         |         |         |         |         |         |         |         |         |         |         |    
ID2 human MKAFsPVRSVRkNsLsDHSLGISRSKtPVDDPMSLLYNMNDCysKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
ID2 mouse MKAFsPVRSVRKNsLSDHSLGISRSKtPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG
ID2 rat MKAFsPVRSVRKNsLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQTSRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG
  ***********************************************************:*************************************:********************************:***
Consensus MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKVLCG
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.