Multiple Sequence Alignment:
TP1 Download MSA
  (        10        20        30        40        50     )
           |         |         |         |         |     
TP1 human MSTSRKLKSHGMRRSKSRsPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL
TP1 mouse MSTSRKLkTHGMRRGKNRAPHKGVKRGGSKRKYRKSVLKSRKRGDDASRNYRSHL
TP1 rat MSTSrkLKTHGMrRGKNrAPHkGVkRGGSKRkYrkssLkSrkRGDDAsRNYRSHL
TP1 sheep -STSRKLKsQGTRRGKNRTPHKGVKRGCSKRKYRKssLKsRKRCDDANRNFRSHL
  :*******::*:**:*:*:********:*******:.******:***:**:****
Consensus MSTSRKLKSHGMRRGKNRAPHKGVKRGGSKRKYRKSSLKSRKRGDDANRNYRSHL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.