Multiple Sequence Alignment:
SIIR Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
SIIR human MDKPRKENEEEPQSRPRPMRRGLRWStLPKss---PPRssLRRssPRRRSS--FLRSSCLSSCLR---CSSRRTPSAGLSRKDLFEGRPPMEQPPCGVGkHkLEEGsFkERLARSRPQFrGDIHGRNLsNEEMIQAADELEEMkRVRNKLMIMHWKAKRSRPYPI
SIIR iso2 human MDKPRKENEEEPQsAPKTDEERPPVEHsPEK------QSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
SIIR mouse MENTRSENEEQPESTLKIDEEQPAVEQSPENQCSEEDQSSEDLSSEEQSSEEEFFPEELLPELLPEMLLSEDRPPQECLSQKNQFEDRIPMEQPPCGVGKHKLEEGSFKERLARIRPQFIGDIHGRNLsNEEMIQAADELEEMkRVRNKLMIMHWKAKRSRPYPI
  *:::*:****:*:*:::.:::.::::.:*:.......:*::..**::::*:::*:::::*:::*:::::*:.*:*:::**:*::**:*:*************************:****:*********************************************
Consensus MDKPRKENEEEPQSAPKIDEERPAVEQSPENQ---EDQSSERRSSEEQSSEEEFFPEELLPELLPEMLLSERRPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPI
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.