Multiple Sequence Alignment:
FABP3 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130   )
           |         |         |         |         |         |         |         |         |         |         |         |         |   
FABP3 human MVDAFLGtWKLVDSKNFDDYMKsLGVGFATRQVASMTKPTtIIEKNGDILTLKTHSTFKNtEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILtLTHGTAVCTRTYEKEA
FABP3 mouse MADAFVGtWkLVDSkNFDDYMkSLGVGFATRQVASMTkPTTIIEkNGDTITIkTQSTFKNTEINFQLGIEFDEVTADDRKVkSLVTLDGGkLIHVQkWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA
FABP3 rat MADAFVGtWkLVDSkNFDDyMksLGVGFAtRQVASMTkPTTIIEkNGDtITIkTHSTFKNTEISFQLGVEFDEVTADDRKVksVVTLDGGkLVHVQkWDGQETTLTRELSDGkLILTLTHGNVVSTRTYEKEA
  *:***:******************************************::*:**:********:*:**:****:*********.********:*:***:******:***.***********.:*:********
Consensus MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSIVTLDGGKLVHVQKWDGQETTLTRELIDGKLILTLTHGNVVSTRTYEKEA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.