Multiple Sequence Alignment:
PRPS2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
PRPS2 human MpNIVLFSGSSHQDLSQRVADRLGLELGkVVTKkFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKsRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLyAEPAVLQWIRENIAEWkNCIIVSPDAGGAkRVTsIADrLNVEFALIHkERKKANEVDrMVLVGDVkDRVAILVDDMADtCGTICHAADkLLsAGAtKVyAILTHGIFSGPAISRINNAAFEAVVVtNTIPQEDkMkHCTKIQVIDISMILAEAIRRTHNGEsVsyLFSHVPL
PRPS2 iso2 human
PRPS2 mouse MPNIVLFSGSSHQDLSQRVADRLGLELGkVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDkKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENITEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHkERKKANEVDRMVLVGDVkDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAIsRINSAAFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGEsVSyLFSHVPL
  ***************************************************************************************************************************************************************:**:***************************************************************************************************:*********************:*********************************
Consensus MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWRNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.