| Multiple Sequence Alignment: | |
| FAM209B | Download MSA |
| ( 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 ) | |
|---|---|
| | | | | | | | | | | | | | | | | | | |
| FAM209B human | |
| FAM209B mouse | |
| *:*.*:::*:*:**::*::******:*:**:*::******:**********::*****:*****::*::::*:*::::*:*.****:******:::*:*:**:**:*::**::****::**:**:****:*:***::***:*:*..:::::*:*:::*:.***::*****:*: | |
| Consensus | MRTLLRSCLFLLLCLSCACAFMFSSLRQKTKEPQGKVPCGEHFRIRQNLPENAQGWLGNKWLWLLFAIMIFVILQCRRDGEKNKEQHPPGLRGCQLRSPLKKAQNASLSKDCTFNTLNQLEMELLKFVSEVRNLKGAMATNSNSNLRQRRPEMPANLYNNVTICEIWGEEDSE |
| Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers. |
| Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT. |