Multiple Sequence Alignment:
LST1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100     )
           |         |         |         |         |         |         |         |         |         |     
LST1 human MLSRN--------DDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERsWAQGSSEQELHYAsLQRLPVPSSEGPDLRGRDKRGTKEDPRADyACIAENKPT
LST1 mouse MSDDNGSGNNCTTNHFLLYGSLGLGGLLLLLVIILFICLCGFSQRVKRLERN--AQVSGQEPHyAsLQQLPVSSSDITDM--------KEDLSTDYACIARSTPT
  *:::*........:::::**:*********:*::*::***::::*******:..:::*:**:******:***:**:::*:........***:::******:::**
Consensus MLDRNGSGNNCTTNDICIYGGLGLGGLLLLAVIILFACLCGLHRRVKRLERNWAAQSSEQELHYASLQRLPVPSSDGPDLRGRDKRGTKEDLRADYACIARNKPT
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.