Multiple Sequence Alignment:
ATP5H Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
ATP5H human MAGRKLALKTIDWVAFAEIIPQNQKAIASsLkSWNETLtSRLAALPENPPAIDWAyykANVAkAGLVDDFEkkFNALkVPVPEDkyTAQVDAEEkEDVksCAEWVsLSkARIVEYEkEMEkMKNLIPFDQMTIEDLNEAFPETkLDkkkyPyWPHQPIENL
ATP5H iso2 human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKK------------------------VKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
ATP5H mouse MAGRKLALkTIDWVSFVEVMPQNQkAIGNALkSWNETFHARLAsLSEkPPAIDWAYYRANVAkPGLVDDFEkkYNALkIPVPEDkYTALVDQEEkEDVksCAEFVsGSQLRIQEYEkQLEKMRNIIPFDQMtIDDLNEIFPETkLDkkkyPyWPHQPIENL
ATP5H rat MAGRKLALKTIDWVSFVEIMPQNQKAIGNALkSWNETFHTRLASLSEkPPAIDWAYYRANVDkPGLVDDFkNkYNALkIPVPEDkYTALVDAEEkEDVkNCAQFVTGSQARVREYEkQLEKIkNMIPFDQMTIDDLNEVFPETkLDKRkYPyWPHQPIENL
ATP5H cow MAGRKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIETL
  **************:*:*::*:****::::*******:::***:*:*:*********:***:*:******::*.::::.:.:::::::.::::::::**:**::::.*::*:.****::**::*.********:****:********:*******:***:*
Consensus MAGRKLALKTIDWVAFAEIIPQNQKAIANSLKSWNETLTSRLAALPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKIPVPEDKYTAQVDAEEKEDVKSCAEFVSGSKARIQEYEKELEKMKNIIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.