Multiple Sequence Alignment:
CYB5R3 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
CYB5R3 human MGAQLSTLGHMVLFPVWFLYsLLMKLFQRStPAITLEsPDIkyPLRLIDREIISHDTRRFRFALPsPQHILGLPVGQHIyLsARIDGNLVVRPYtPISSDDDKGFVDLVIKVYFkDTHPkFPAGGkMSQYLESMQIGDTIEFRGPsGLLVYQGkGKFAIRPDkkSNPIIRtVksVGMIAGGtGItPMLQVIRAIMkDPDDHTVCHLLFANQTEkDILLRPELEELRNKHSARFkLWYTLDRAPEAWDyGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF
CYB5R3 iso2 human -----------------------MKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFVF
CYB5R3 mouse MGAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIkYPLRLIDkEVIsPDTRRFRFALPsPQHILGLPIGQHIyLSTRIDGNLVIRPYTPVSSDDDkGFVDLVVKVYFkDTHPkFPAGGkMSQyLENMkIGDTIEFRGPNGLLVYQGkGKFAIRADKKSNPVVRTVksVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEkDILLRPELEELRNEHsARFkLWYTVDkAPDAWDYSQGFVNEEMIRDHLPTPGEEPLILMCGPPPMIQFACLPNLERVGHPKERCFtF
CYB5R3 rat MGAQLSTLSRVVLSPVWFVYSLFMkLFQRSSPAITLENPDIkYPLRLIDkEIISHDTRRFRFALPSPQHILGLPIGQHIyLSTRIDGNLVIRPYTPVSSDDDKGFVDLVVKVYFkDTHPkFPAGGKMSQYLENMNIGDTIEFRGPNGLLVYQGKGkFAIRADKKSNPVVRTVKSVGMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQSEKDILLRPELEELRNEHSSRFKLWYTVDKAPDAWDYSQGFVNEEMIRDHLPPPGEETLILMCGPPPMIQFACLPNLERVGHPKERCFtF
  ::::::::...::.::::.:::.*******:******:***********:*:**:*******************:*******:*******:*****:************:**********************:*.**********:**************:******::************************::***:*****:******:***************:**:*******:*:**:****:**************:*:**:*:**********:******::****:****:*
Consensus MGAQLSTLSHVVLSPVWFIYSLFMKLFQRSTPAITLENPDIKYPLRLIDREIISHDTRRFRFALPSPQHILGLPIGQHIYLSARIDGNLVIRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLENMQIGDTIEFRGPNGLLVYQGKGKFAIRADKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAILKDPNDHTVCHLLFANQSEKDILLRPELEELRNEHSARFKLWYTLDRAPDAWDYGQGFVNEEMIRDHLPPPEEEPLILMCGPPPMIQFACLPNLDRVGHPKERCFTF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.