Multiple Sequence Alignment:
NDUFS4 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170     )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |     
NDUFS4 human MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPtRsLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFsWNkRTRVsTK
NDUFS4 mouse MAAVSISVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIkTRKVRIFVPARNNMQSGVNNTkKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEkKVPKPKSKSYGANFSWNkRTRVsTK
NDUFS4 rat
NDUFS4 cow MAAVSMSVALRQALWGRRVATVAAVSVSKVSTRSLSTSTWRLAQDQTRDTQLITVDEKLDITTITGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAVAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVsTK
  *****:**:***::::**::::**:**::*::*:*:****:**::**:***************:************:**********************************************:*****:****::**********:**:*************************
Consensus MAAVSMSVALRQALWGRRAAAVAAVSVSRVPTRSLSTSTWRLAQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.