Multiple Sequence Alignment:
G-gamma 2 Download MSA
  (        10        20        30        40        50        60        70 )
           |         |         |         |         |         |         | 
G-gamma 2 human
G-gamma 2 mouse
  ***********************************************************************
Consensus MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.