Multiple Sequence Alignment:
ERH Download MSA
  (        10        20        30        40        50        60        70        80        90       100    )
           |         |         |         |         |         |         |         |         |         |    
ERH human MsHtILLVQPtkRPEGrTYADYEsVNECMEGVCkMyEEHLkRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQtyQPyNkDWIKEkIyVLLRRQAQQAGK
ERH mouse MsHTILLVQPTkRPEGRTYADYEsVNECMEGVCKMyEEHLkRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPyNkDWIKEKIyVLLRRQAQQAGK
  ********************************************************************************************************
Consensus MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.