Multiple Sequence Alignment:
DCD Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110)
           |         |         |         |         |         |         |         |         |         |         |
DCD human MRFMTLLFLTALAGALVCAyDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEkGLDGAKKAVGGLGKLGkDAVEDLESVGKGAVHDVKDVLDSVL
DCD rat MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGkLGKDAVEDLESVGKGAVHDVkDVLDSVL
  **************************************************************************************************************
Consensus MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.