Multiple Sequence Alignment:
SUMO2 Download MSA
  (        10        20        30        40        50        60        70        80        90     )
           |         |         |         |         |         |         |         |         |     
SUMO2 human MADEkPkEGVktENNDHINLkVAGQDGsVVQFkIkRHtPLSkLMkAYCErQGLsMRQIRFRFDGQPINETDTPAQLEMEDEDtIDVFQQQTGGVY
SUMO2 iso2 human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQ------------------------LEMEDEDTIDVFQQQTGGVY
SUMO2 mouse MADEKPKEGVkTENNDHINLkVAGQDGsVVQFkIkRHtPLSkLMkAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
SUMO2 rat MADEkPkEGVkTENNDHINLKVAGQDGSVVQFkIKRHTPLSkLMkAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
  ***************************************************::::::::::::::::::::::::********************
Consensus MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.