Multiple Sequence Alignment:
UQCRH Download MSA
  (        10        20        30        40        50        60        70        80        90 )
           |         |         |         |         |         |         |         |         | 
UQCRH human MGLEDEQKMLtESGDPEEEEEEEEELVDPLTTVREQCEQLEkCVKARERLELCDERVSSRsHtEEDCTEELFDFLHARDHCVAHkLFNNLK
UQCRH pig MGLEDEQRMLTGSGDPKEEEEEEEELVDPLTTVREQCEQIEKCIKARERLELCDQRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNsLK
UQCRH cow MGLEDEQRMLTGSGDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
  *******:***:****:**********************:***:**********:******:*********:****************:**
Consensus MGLEDEQRMLTGSGDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELFDFLHARDHCVAHKLFNSLK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.