Multiple Sequence Alignment:
VDAC2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         
VDAC2 human ---------------MATHGQtCARPMCIPPSYADLGkAARDIFNkGFGFGLVkLDVKtksCsGVEFStsGssNTDTGkVtGtLETkykWCEyGLTFTEKWNTDNTLGTEIAIEDQICQGLKLtFDttFsPNtGkkSGKIKSsYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAkSKLTRNNFAVGyRTGDFQLHTNVNDGtEFGGSIyQKVCEDLDTSVNLAWTSGTNCTRFGIAAkyQLDPTASIsAkVNNssLIGVGytQtLRPGVKLTLSALVDGkSINAGGHkVGLALELEA
VDAC2 iso1 human MSWCNELRLPALKQHSIGRGLESHITMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
VDAC2 iso2 human --------------------------MCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
VDAC2 mouse --------------MAECCVPVCPRPMCIPPPYADLGkAARDIFNkGFGFGLVkLDVKTKSCSGVEFSTSGSSNTDTGkVSGtLETkYkWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDttFsPNtGkkSGKIKSAYkRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGtEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAkVNNsSLIGVGYTQtLRPGVKLTLSALVDGksFNAGGHkLGLALELEA
VDAC2 rat --------------MAECCVPVCQRPICIPPPYADLGKAARDIFNkGFGFGLVkLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETkYkWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFsPNTGkKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIyQKVCEDFDTSVNLAWTSGTNCTRFGIAAkyQLDPTASISAkVNNSSLIGVGYTQTLRPGVKLTLSALVDGkSFNAGGHkLGLALELEA
VDAC2 pig ---------------MATHGQTCPRPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECVNLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNssLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELEA
                ........:.:::****:************************************************:*************************************************************:*****:*******************************************:******************:***************:*****************************************************************:******:********
Consensus ---------------AACCGQTCPRPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELEA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.