Multiple Sequence Alignment:
H1F0 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
H1F0 human MtENsTsAPAAkPkRAKASKKSTDHPkYSDMIVAAIQAEkNRAGSSRQSIQkYIKSHykVGENADsQIKLSIKRLVTTGVLkQtkGVGAsGsFRLAKSDEPkKSVAFkKTKKEIKKVAtPkKAsKPKKAASKAPTKKPKAtPVKKAKKkLAAtPkKAKKPkTVKAKPVKAsKPKKAKPVKPKAKSSAKRAGKKK
H1F0 iso2 human -----------------MTKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
H1F0 mouse MtEnsTSAPAAKPKRAKASKKSTDHPkYSDMIVAAIQAEkNRAGSSRQsIQKYIKSHYkVGENADsQIKLSIKRLVTTGVLkQTkGVGASGsFRLAKGDEPKRSVAFKKTKKEVKKVATPKKAAKPKKAASKAPSKKPKAtPVKKAKKkPAATPkKAKKPKVVKVKPVKASKPKKAKTVKPKAKSSAKRASKKK
H1F0 rat MTENSTSTPAAkPKRAKAAKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQkYIKSHYkVGENADSQIKLSIKRLVTTGVLkQTKGVGASGSFRLAkGDEPKRSVAFkKTKKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKIVKVKPVKASKPKKAKPVKPKAKSSAKRASKKK
  :::::::.:::::::::::******************************************************************************:****:**********:*********:**********:**************:***********.**:************:************:***
Consensus MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKTKKEIKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.