Multiple Sequence Alignment:
ATP5I Download MSA
  (        10        20        30        40        50        60        70 )
           |         |         |         |         |         |         | 
ATP5I human MVPPVQVsPLIKLGRYSALFLGVAyGAtRyNyLkPRAEEERRIAAEEKkkQDELKRIARELAE--DDsILk
ATP5I mouse MVPPVQVsPLIKFGRYSALIIGMAyGAkRysyLKPRAEEERRIAAEEKKRLDELKRIERELAEAQDDsILk
ATP5I rat MVPPVQVSPLIkFGRYSALILGMAYGAkRYSyLkPRAEEERRIAAEEKkRLDELkRIERELAEAEDVsIFK
  ************:******::*:****:**:******************::******:*****:.*:**:*
Consensus MVPPVQVSPLIKFGRYSALILGMAYGAKRYSYLKPRAEEERRIAAEEKKRLDELKRIERELAEAQDDSILK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.