Multiple Sequence Alignment:
ATP5J Download MSA
  (        10        20        30        40        50        60        70        80        90       100        )
           |         |         |         |         |         |         |         |         |         |        
ATP5J human MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQkLFVDkIREYkSKRQTSGGPVDAssEyQQELERELFKLkQMFGNADMNTFPTFkFEDPkFEVIEkPQA
ATP5J mouse MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNkELDPVQkLFVDkIREYkSKRQASGGPVDIGPEYQQDLDRELYkLkQMYGkGEMDtFPTFkFDDPkFEVIDkPQs
ATP5J rat MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQkLFLDkIREYkAKRLAsGGPVDTGPEYQQEVDRELFKLkQMYGkGEMDkFPTFNFEDPkFEVLDkPQs
ATP5J cow MILQRLFRLSSAVQSAISVSWRRNIGITAVAFNKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPNFTFEDPKFEVVEKPQS
  *::**:**:**:::**:**:::****:***********:****:******::**::******:::****:::***:*****:*:::*::**:*.*:******::***:
Consensus MILQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPTFKFEDPKFEVIDKPQS
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.