Multiple Sequence Alignment:
POLR2L Download MSA
  (        10        20        30        40        50        60       )
           |         |         |         |         |         |       
POLR2L human MIIPVRCFTCGkIVGNkWEAYLGLLQAEYTEGDALDALGLkRYCCRRMLLAHVDLIEkLLNyAPLEk
POLR2L mouse MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEkLLNYAPLEk
  *******************************************************************
Consensus MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.