Multiple Sequence Alignment:
UBL5 Download MSA
  (        10        20        30        40        50        60        70   )
           |         |         |         |         |         |         |   
UBL5 human MIEVVCNDRLGkKVRVkCNtDDTIGDLkkLIAAQTGTRWNkIVLKkWYTIFKDHVSLGDYEIHDGMNLELYYQ
UBL5 mouse MIEVVCNDRLGKKVRVKCNTDDTIGDLkKLIAAQTGTRWNKIVLKkWYTIFKDHVSLGDYEIHDGMNLELYYQ
  *************************************************************************
Consensus MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.