Multiple Sequence Alignment:
H2AFJ Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120         )
           |         |         |         |         |         |         |         |         |         |         |         |         
H2AFJ human MsGRGkQGGkVRAKAKSRSsrAGLQFPVGrVHRLLRkGNyAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPrHLQLAIrNDEELNkLLGkVtIAQGGVLPNIQAVLLPkktEsQkTKSK
H2AFJ mouse MSGRGkQGGkVRAKAKSRSSRAGLQFPVGRVHRLLRkGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNkLLGRVtIAQGGVLPNIQAVLLPkktESQkVKSK
H2AFJ rat MSGRGkQGGkVRAKAKSRSSRAGLQFPVGRVHRLLRkGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNkLLGRVtIAQGGVLPNIQAVLLPkkTESQKVKSK
  ***************************************************************************************************:*************************:***
Consensus MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESQKVKSK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.