Multiple Sequence Alignment:
PTMA Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110 )
           |         |         |         |         |         |         |         |         |         |         | 
PTMA human MsDAAVdtssEItTkDLkEkkEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKrAAEDDEDDDVDtkkQktDEDD
PTMA iso2 human MSDAAVDTSSEITTKDLkEKKEVVEEAENGRDAPANGNA-NEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTkkQKtDEDD
PTMA mouse MsDAAVDtssEIttkDLKEkkEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVDTkkQktEEDD
PTMA rat
PTMA cow MSDAAVDtSSEIttKDLKEKKEVVEEAENGREAPANGNA-NEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD
  *******************************:*******.********************************************::****:****************:***
Consensus MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNA-NEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.