Multiple Sequence Alignment:
SRP9 Download MSA
  (        10        20        30        40        50        60        70        80      )
           |         |         |         |         |         |         |         |      
SRP9 human MpQyQTWEEFSRAAEkLYLADPMkARVVLkYrHsDGNLCVkVtDDLVCLVYkTDQAQDVkkIEkFHsQLMrLMVAkEARNVtMEtE
SRP9 iso2 human MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVRQCLALLLRLQCSGMIIAHCI-LDLLGSSG--PLASAS-
SRP9 mouse MPQFQTWEEFSRAAEkLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVkKIEKFHSQLMRLMVAKESRNVtMEtE
  ***:********************:********:*****:*******::::::::::::::::::*:::::*:::::.::::::::
Consensus MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYATDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.