Multiple Sequence Alignment:
H2B1N Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120      )
           |         |         |         |         |         |         |         |         |         |         |         |      
H2B1N human MPEPskSAPAPkkGSkkAVTkAQkkDGKKRKRsRkEsysVyVykVLkQVHPDtGIsskAMGIMNsFVNDIFErIAGEAsrLAHyNkrstItsrEIQtAVrLLLPGELAkHAVsEGtkAVtkytsSk
H2B1N mouse MPEPsksAPAPkkGSkkAISkAQkkDGKKRKRSRkEsysVyVykVLkQVHPDTGIsskAMGIMNsFVNDIFERIAsEASRLAHyNkRstITsREIQtAVRLLLPGELAkHAVsEGtkAVtkYtSSk
  ******************::*******************************************************:**************************************************
Consensus MPEPSKSAPAPKKGSKKAISKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.