Multiple Sequence Alignment:
H2B1H	Download MSA

	( 10 20 30 40 50 60 70 80 90 100 110 120 )
	\| \| \| \| \| \| \| \| \| \| \| \|
H2B1H human	MPDPa K5-ac K5-ub K5-sm kSAPAp kKGs kKAVt K20-ac K20-m1 K20-ub K20-sm KAq kKDGKKRKrSr K34-ac K34-ub K34-sc Ke s ySvYvy K43-ac K43-m1 K43-ub K43-sc KVl K46-ac K46-ub K46-sm K46-sc KQVHPdTGi ss K57-ac K57-ub KAMGIMnSFVNDIFeRIAGEa sRLAhYn K85-ac K85-ub K85-sc k r sTi t sREIqTAvRLLLPGELa K108-ac K108-ub K108-sm KHAvSEgt K116-ac K116-ub K116-sm K116-sc KAvt K120-ac K120-ub K120-sm K120-sc k y tSs K125-ac K125-ub K
H2B1H mouse	MPDPa K5-ac K5-ub kSAPAp kKGs kKAVtKVqKKDGKKRKRSrKe s ySvYvy K43-ac K43-ub K43-sc KVl K46-ac K46-ub KQVHPDTGi s sKAMGIMnSFVNDIFERIAGEaSRLAhYn K85-ac K85-ub Kr sTItSREIqTAVRLLLPGELa K108-ac K108-ub KHAvSEg tKAvt K120-ac K120-ub K120-sc KyTSsK
	*******************:******************************************************************************************************
Consensus	MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.

Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.