Multiple Sequence Alignment:
ANXA5 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320 )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         | 
ANXA5 human MAQVLrGTVtDFPGFDErADAEtLRkAMkGLGtDEEsILtLLtsRSNAQRQEISAAFkTLFGRDLLDDLkSELtGkFEkLIVALMkPsRLyDAyELkHALkGAGtNEkVLtEIIAsRtPEELRAIkQVyEEEyGssLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELkWGTDEEkFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVkSIRsIPAYLAEtLyyAMkGAGtDDHtLIRVMVsRsEIDLFNIRKEFRkNFATsLysMIkGDTSGDYkkALLLLCGEDD-
ANXA5 mouse --MATRGTVTDFPGFDGRADAEVLRKAMkGLGTDEDsILNLLTSRSNAQRQEIAQEFkTLFGRDLVDDLkSELTGkFEkLIVAMMkPSRLYDAyELkHALkGAGTDEkVLTEIIASRTPEELSAIKQVYEEEYGsNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEkFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLyYAMkGAGTDDHTLIRVVVSRSEIDLFNIRKEFRkNFATSLysMIKGDTSGDYkKALLLLCGGEDD
ANXA5 rat --MALRGTVTDFSGFDGRADAEVLRKAMkGLGTDEDsILNLLTARSNAQRQQIAEEFkTLFGRDLVNDMkSELTGkFEkLIVALMkPSRLYDAyELkHALkGAGTDEkVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEkFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVkSIRSIPAYLAETLYYAMkGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIkGDTSGDYKKALLLLCGGEDD
ANXA5 cow MAQVLRGTVADFPGFDERADAETLRKAMKGLGTDEETILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIEQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLYNIRKEFRKNFGTSLYSMIKGDTSGDYKKALLLLCGGEDD
ANXA5 iso2 cow -AQVLRGTVADFPGFDERADAEtLRKAMKGLGTDEESILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLYNIRKEFRKNFGTSLYSMIKGDTSGDYKKALLLLCGGEDD
ANXA5 iso3 cow -AQVLRGTVADFPGFDERADAEtLRKAMKGLGTDEETILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIEQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLYNIRKEFRKNFGTSLYSMIKGDTSGDYKKALLLLCGGEDD
  .::::****:**:***:*****:************::**:***:*******:*:::*********::*:**************:*********************:****************:**:*:*******:****************************::**:****:***********************:*********:**************************:*************************************:********:**********:************************::*:
Consensus -AQVLRGTVADFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEIAVAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDARIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.