Multiple Sequence Alignment:
PPP1R14B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |       
PPP1R14B human MADsGTAGGAALAAPAPGPGsGGPGPrVyFQsPPGAAGEGPGGADDEGPVRRQGKVtVkYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVkELLVDCykPTEAFISGLLDKIRGMQKLstPQkK
PPP1R14B mouse MADSGPAGGAALAAPAPGPGSGSTGPRVYFQsPPGAAGEGPGGADDDGPVRRQGKVtVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDTRAARVkELLVDCYKPTEAFISGLLDKIRGMQKLStPQKK
PPP1R14B rat
  *****:****************::**********************:************************************************************:***************************************
Consensus MADSGPAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDDGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.