Multiple Sequence Alignment:
TBCA Download MSA
  (        10        20        30        40        50        60        70        80        90       100        )
           |         |         |         |         |         |         |         |         |         |        
TBCA human MADPRVRQIkIkTGVVkRLVKEkVMYEkEAKQQEEkIEkMRAEDGENyDIkkQAEILQEsrMMIPDCQRRLEAAyLDLQRILENEkDLEEAEEykEARLVLDsVkLEA
TBCA mouse MADPRVRQIkIKTGVVRRLVKERVMYEkEAkQQEEKIEKMKAEDGENyAIkkQAEILQESRMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYkEARVVLDSVKLEA
TBCA rat
  ****************:*****:*****************:*******:**************************:***:***:**************:*********
Consensus MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMRAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.