Multiple Sequence Alignment:
SRP19 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |    
SRP19 human MACAAARsPADQDrFICIYPAYLNNKKTIAEGRRIPIsKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRkSVMLYAAEMIPKLKTRTQkTGGADQSLQQGEGsKKGKGKKKK
SRP19 iso3 human
SRP19 mouse MACSAARPPADQDRFIFIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPILQQGEGSKKGKGKKKK
SRP19 rat MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPINKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLyVAEMIPKLKTRTQKSGGADPSLQQGEGSKKGKGKKKK
  ***:***:******::.*:::::::::::::::::::.:::::::::::::::::::::.:*:::***:::::::::.*::::::*::*:*:::::::::::::::::::::::::::*::.:*::..:::*::::::::::::
Consensus MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQKSGGADPSLQQGEGSKKGKGKKKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.