Multiple Sequence Alignment:
CCL6 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120 )
           |         |         |         |         |         |         |         |         |         |         |         | 
CCL6 human MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRK-N
CCL6 mouse MRNSKTAISFFILVAVLGSQAGLIQEMEKE----DRRYNPPIIHQGFQDTSSDCCFSYATQ-IPCKRFIyyFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
CCL6 rat
  *::*::*:*:::**::*****::::::*:*....::::::*:::::*::**:***:**:::.***:::::**:*:::*:***:**::::*:::**:***::**:*:::**:::*:::::.:
Consensus MRNSKAAISCLILVAALGSQARLIQDAEKEFMMSDRRLNNPIIHDRFQATSADCCISYAPRSIPCKRLESYFETNGECIKPGIIFISRRGRRFCANPSDRRVQRCLRMLKQDPRIGNRKIA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.