Multiple Sequence Alignment:
S100A10 Download MSA
  (        10        20        30        40        50        60        70        80        90       )
           |         |         |         |         |         |         |         |         |       
S100A10 human MPSQMEHAMETMMFTFHkFAGDkGyLtkEDLRVLMEkEFPGFLENQkDPLAVDkIMkDLDQCRDGKVGFQSFFSLIAGLTIACNDyFVVHMKQKGKK
S100A10 mouse MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQkDPLAVDkIMkDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVNMkQKGKK
S100A10 rat MPSQMEHAMETMMLTFHRFAGEkNyLTkEDLRVLMEREFPGFLENQkDPLAVDkIMkDLDQCRDGKVGFQSFLSLVAGLIIACNDYFVVHMKQK--K
  *************:***:***:*.:***********:***********************************:**:***:*********:****::*
Consensus MPSQMEHAMETMMLTFHRFAGDKNYLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFLSLVAGLTIACNDYFVVHMKQKGKK
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.