Multiple Sequence Alignment:
HMGA1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       )
           |         |         |         |         |         |         |         |         |         |       
HMGA1 human MsESSskssQPLAskQEkDGtEkrGrGRPRkQPPVsPGtALVGsQkEPsEVPtPkRPrGrPkGskNkGAAktrkttttPGrkPrGrPkKLEKEEEEGIsQEssEEEQ
HMGA1 iso2 human MSESSSKSSQPLASkQEkDGtEkrGrGRPRkQPP-----------KEPsEVPtPkrPrGrPKGskNkGAAkTRkTTTtPGRkPrGRPKKLEkEEEEGIsQEssEEEQ
HMGA1 mouse MsESGskSsQPLASkQEKDGTEKRGRGRPRKQPPVsPGtALVGsQkEPsEVPtPKRPRGRPKGSKNKGAAKTRKVtTAPGRKPRGRPKKLEKEEEEGIsQEssEEEQ
HMGA1 iso2 mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPP-----------KEPSEVPtPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ
HMGA1 iso3 mouse MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKL-KEEEEGIsQEssEEEQ
HMGA1 rat MSESVSkSSQPLASkQEkDGTEKRGRGRPRKQPSVSPGTALVGsQKEPSEVPtPKRPRGRPKGsKNKGTAKTRKVTTtPGRKPRGRPKKLEKEEEEGIsQEssEEEQ
  ****:****************************::::::::::::***********************:*****:**:************:****************
Consensus MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.