Multiple Sequence Alignment:
NCBP2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |      
NCBP2 human MSGGLLkALRSDsyVELsQYRDQHFRGDNEEQEkLLKKSCTLYVGNLSFYTTEEQIyELFSKSGDIKKIIMGLDkMKKtACGFCFVEYySRADAENAMRYINGTRLDDRIIRTDWDAGFkEGRQYGRGRsGGQVRDEyrQDyDAGrGGYGkLAQNQ
NCBP2 iso2 human ------------------MVLRKLYAGDNEEQEkLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NCBP2 iso3 human MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKs-----------------------------------------------------YAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NCBP2 mouse MSGGLLKALRSDsYVELSEYRDQHFRGDNEEQEkLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKkIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGrGGYGKLAQKQ
  ::::::::::::::::::.:::::::*************::::::::::::::::::::::::::::::::::::::::::::::::::::::**********************************************:**************:*
Consensus MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.