Multiple Sequence Alignment:
neurogranin Download MSA
  (        10        20        30        40        50        60        70        )
           |         |         |         |         |         |         |        
neurogranin human MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQAsFrGHMARKKIKSGERGRKGPGPGGPGGAGVArGGAGGGPSGD
neurogranin mouse MDCCTESACSkPDDDILDIPLDDPGANAAAAKIQAsFRGHMARKKIKSGECGRkGPGPGGPGGAGGArGGAGGGPSGD
neurogranin rat
neurogranin cow MDCCTESACSKPDDDILDIPLDDPGANAAAAKIQAsFRGHMARKKIKSGERGRKGPGPGGPGGAGGARGGAGGGPSGD
  ******:*******************************************:**************:************
Consensus MDCCTESACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGGARGGAGGGPSGD
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.