Multiple Sequence Alignment:
S100A9 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110     )
           |         |         |         |         |         |         |         |         |         |         |     
S100A9 human MTCKM-SQLERNIETIINTFHQYsVKLGHPDtLNQGEFkELVRKDLQNFLKKENKNEKVIEHIMEDLDtNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGtP
S100A9 mouse MANKAPsQMERSITTIIDTFHQYSRKEGHPDtLSkKEFRQMVEAQLAtFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPR-GHGHShGKGCGK-
S100A9 rat MAAKTGSQLERSISTIINVFHQYSRkYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPR-GHDHSHGKGCGK-
  *::*:.**:**:*.***::*****:*.******:::**:::*.::*::*:*:*::**:::.:********:*:******::***::*::*:***:**::::.**.*::*:*:*:.
Consensus MAAKAGSQLERSIETIINTFHQYSRKEGHPDTLNKAEFKEMVRKDLANFLKKEKRNEALIRDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPR-GHDHSHGKGCGK-
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.