Multiple Sequence Alignment:
H3 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130     )
           |         |         |         |         |         |         |         |         |         |         |         |         |     
H3 human ArtkQtArkstGGkAPrkQLATkAArksAPATGGVkkPHryrPGtVALrEIRRYQkstELLIrkLPFQRLVREIAQDFktDLrFQssAVMALQEACEAyLVGLFEDtNLCAIHAkRVtIMPkDIQLArRIRGERA
H3 mouse ARtkQTARkstGGkAPrkQLATkAArksAPATGGVkkPHryRPGtVALREIRRyQkstELLIRkLPFQRLVREIAQDFktDLRFQSSAVMALQEACEAyLVGLFEDTNLCAIHAkRVTIMPkDIQLArrIRGERA
H3 iso2 mouse ARTkQTARksTGGkAPRkQLATkAARKsAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFkTDLRFQSSAVMALQEASEAyLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
H3 iso3 mouse ARtKQTARksTGGkAPRkQLATkAArksAPSTGGVkkPHrYRPGtVALREIRRYQKSTELLIRKLPFQRLVREIAQDFktDLRFQsAAIGALQEASEAyLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
H3 rat ARtkQTARkstGGkAPRkQLATkAARksAPATGGVKKPHRYRPGTVALREIRRYQkstELLIRKLPFQRLVREIAQDFktDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPkDIQLARRIRGERA
H3 iso3 rat ARTkQTARksTGGkAPRkQLATkAARkSAPSTGGVkKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQsAAIGALQEAsEAYLVGLFEDTNLCAIHAKRVTIMPkDIQLARRIRGERA
H3 pig ARTKQTARkSTGGkAPRKQLATKAARkSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
H3 chicken ARTkQTARksTGGkAPRKQLATKAARksAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
H3 cow ARTkQTARkSTGGKAPRkQLATKAARkSAPSTGGVkKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
  ******************************:*******************************************************:*::*****:***************************************
Consensus ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.