Multiple Sequence Alignment:
GCAP2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200    )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |    
GCAP2 human MGQEFSWEEAEAAG---EIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQT-EQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKsAMF
GCAP2 mouse MGQQLSWEEAEAAG---EMDVAELQEWYKKFVVECPSGTLFMHEFKRFFKVTGNEEASQYVESMFRAFDKNGDNTIDFLEYVAALNLVLRGSLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDLEHQGQLLTPEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKMLQMDINPGCWITQQRRRSAMF
GCAP2 cow MGQQFSWEEAEENGAVGAADAAQLQEWYKKFLEECPSGTLFMHEFKRFFKVPDNEEATQYVEAMFRAFDTNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRQELLDIVESIYKLKKACSVEVEAEQQGKLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDLNPSSWISQQRRKsAMF
  ***::******::*...::*:*:********:.******************:::***:****:******:*********************:***************:******:***:***:**:*****::*:.::.**:*************************:**:****************.**::*::****:****
Consensus MGQQFSWEEAEAAG---EADVAELQEWYKKFVEECPSGTLFMHEFKRFFKVTDNEEASQYVEAMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKLKKACRAELDAEQQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDINPSSWIAQQRRKSAMF
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.