Multiple Sequence Alignment:
NHP2L1 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120        )
           |         |         |         |         |         |         |         |         |         |         |         |        
NHP2L1 human MTEADVNPkAYPLADAHLTkkLLDLVQQsCNykQLRkGANEATkTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVsRPVIACSVTIkEGSQLkQQIQSIQQsIERLLV
NHP2L1 mouse MTEADVNPKAYPLADAHLTkkLLDLVQQSCNykQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLkQQIQSIQQsIERLLV
NHP2L1 rat
  ********************************************************************************************************************************
Consensus MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.