Multiple Sequence Alignment:
G6B Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250   )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |   
G6B human MAVFLQLLPLLLsRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDsGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPP----QPIRPLPRFAPLVKtEPQRPVKEEEPKIPGDL--------DQEPSLLyADLDHLALsRPRRLstADPADASTIyAVVV
G6B iso2 human MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPP----QPIRPLPRFALsPPHSsTCENRAPEASKGGRAQDSRGPGPGTEPALCG--------SGPSSPQQAPPAVHSGPC----
G6B iso5 human MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCkAPGPTH------------------------------------------------APLVKTEPQRPVKEEEPKIPGDL--------DQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVVV
G6B mouse MALVLPLLPLLLSKVQGNPEVSLEGSPGDRVnLSCIGVSDPTRWAWAPSFPACKGLSKGRRPILWASTRGtPtV--LQHFSGRLRsLDNGIKRLELLLSAGDSGTFFCKGRHENESRTVLQVLGDKAGCRPAGSTHGYEYPKVLIPLLGVGLVLGLGVAGVVWRRRRLSPPPPPPPPPGPLPTFAPVINAEPQRPLEQE-SKISGH--------LDQEPSLHyADLDHSVLGRHRRMSTVVSGDASTVYAVVV
G6B rat
  **::*:*******::****::**:*:*********:***:*:**:**********************::*****::**:*:*******:**:*********************:******:****:::*:::*:**:..::..::::::.:::::::.::.::...:..::    .:..:::.:*:...::::::..::::::.*.:       .::**:*.::::::..::::::.:::.::::*:.:::::
Consensus MAVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQLLIPLLGAGLVLGLGALGLVWWLHRRLPP----QPIRPLPRFAPLVKTEPQRPVKEEEPKIPGDL--------DQEPSLLYADLDHLALSRPRRLSTADPADASTIYAVVV
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.