Multiple Sequence Alignment:
ZC3H14 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740        )
           |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |         |        
ZC3H14 human MEIGtEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTtEPSSLkSSDTNIFDSNVPSNkSNFSRGDERRHEAAVPPLAIPSARPEkRDsRVstSSQESktTNVRQtyDDGAATRLMsTVkPLREPAPSEDVIDIkPEPDDLIDEDLNFVQENPLsQkkPtVTLtYGSSRPsIEIyRPPASRNADsGVHLNRLQFQQQQNsIHAAkQLDMQSSWVyETGRLCEPEVLNsLEEtysPFFRNNsEkMsMEDENFRKRkLPVVssVVkVKkFNHDGEEEEEDDDyGsRtGsISSSVSVPAkPERRPsLPPskQANkNLILkAISEAQEsVtkttNysTVPQkQtLPVAPRTRtsQEELLAEVVQGQsRtPRIsPPIkEEEtkGDsVEkNQGTQQRQLLsRLQIDPVMAEtLQMsQDyyDMEsMVHADTRSFILKkPkLsEEVVVAPNQESGMkTADsLRVLsGHLMQTRDLVQPDkPAsPKFIVTLDGVPs---PPGyMsDQEEDMCFEGMKPVNQTAAsNkGLRGLLH-----PQQLHLLsRQLED----PNGsFSNAEMSELSVAQkPEKLLERCKYWPACKNGDECAYHHPIsPCkAFPNCkFAEkCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLsPKPAVAPPAPPSSSQLCRYFPACkkMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALkWIRPQtsE
ZC3H14 iso2 human MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMAETLQMSQDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPS---PPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGLLH-----PQQLHLLSRQLED----PNGSFSNAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLsPKP-VAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 iso3 human MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDsVEKNQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEMSELSVAQkPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLsPKP-VAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 iso4 human ----------------------------------MVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRtPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMAETLQMSQ-----------------------------------------------------------------------------------------------------------------------------------------------AEMSELSVAQkPEKLLERCKYWPACKNGDECAYHHPIsPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 iso5 human MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDsVEkN-------------------------QDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPS---PPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGLLH-----PQQLHLLSRQLED----PNGSFSNAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 iso6 human -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MRMSSKFPSPPLPIFLPP--------------------------------------------------------EPVDLGSITSSS-----CSLNELDNISHLLR------KIsADINEIKGMKAAIL--TVEANLFDLNVRVsKNEAKISSLEVKMNEYSTTYECNRQFEDQEEDTES-------QSRTTDVKIIGFLRNVEKGTQQRQLLSRLQIDPVMAETLQMSQAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLsPKPV-APPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 iso9 human MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMAETLQMSQDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPS---PPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGLLH-----PQQLHLLSRQLED----PN-----AEMSELSVAQkPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKP-VAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
ZC3H14 mouse MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVttEPssLKsPDAsIFDSHVPSNKSSFSRGDERRHEAAVPPLAVSSSRPEKRDSRVsTSsQEQKSTNVRHsYDDGASTRLMSTVKPLREPAPSEDVIDIkPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPsIEIYRPPASRNADTGTHLNRLQLHPQQSSAHAAkQLDVQSSQVSEAGRLCEPPVLSSVEDTYsPFFRNNLDkMSIEDENFRKRKLPVVSsVVKVKRFsHDGEEEEEDEDYGTRIGSLSSSVSVPAkPERRPsLPPSKQANKNLILKAISEAQESVTkTTNYSAVPQkQTLPVAPRTRtsQEELLAEMVQGQNRAPRIsPPVKEEEAkGDNTGkSQGTQQRQLLsRLQIDPVMVETMEMSQDYYDMESMVHADTRSFILKKPKLsEEIVVtPNQDSGMkTADALRVLSGHLMQTRDLVQPDkPAsPKFIVTLDGVPs---PPGyMsDQEEEMCFEGMKPVNQTSASNKGLRGLLH-----PQQLHLLSRQLED----PDGSFSNAEMTDLSVAQKPEKLLERCKYWPACKNGDECVYHHPIsPCKAFPNCKFAEKCLFVHPNCKYDTKCTKADCPFTHMSRRAsILTPKP-VSsPAPSSNGQLCRyFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTITVPPRHALKWIRPQssE
ZC3H14 rat MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKsPDTSIFDSNVPSNKSSFSRGDERRHEAAIPPLAVSSSRPEKRDSRVSTSSQEHKSTNVRHSYDDGASTRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENSLSQKKPTVTLTYGSSRPSIEIYRPPASRNADTGTHLNRPQLQQQQSSTHTAKQLDGQSSQVYEAGRLCEPEVLGSVEDTYSPFFRNNLDKMNIEEENFRKRKLPVVSSVVKVKRFsHDGEEEEEDEDYGTRVGSLSSSVSVPAKPERRPsLPPSKQANKNLILKAISEAQESVTKTTNYPAVPQKQTLPVAPRTRTSQEEVLAEMVQGQNRAPRIsPPVKEEEAKGDNAEKIEGTQQRQLLSRLQIDPVTVDTMELSQDYYDMESMVHADTRSFILKKPKLSEEIVVtPNQDSGMKTADALRVLSGHLMQTRDLVQPDKPAsPKFIVTLDGVPS---PPGYMSDQEEEMCFEGMKPVNQTSASNKGLRGLLH-----PQQLHLLSRQLED----PDGSFSNAEMTDLSVAQKPEKLLERCKYWPACKNGDECVYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKADCPFTHMSRRGPVLTPKPAVSSPAPSSNGQFCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTITVPPRHALkWIRPQTSE
ZC3H14 cow MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTDPASLKSSDTNLFDGNVPSNKSSFSRGDERRHEAAVPPLAVSSTRPEKRESRVSTSSQEQKATNVRQTYDDGAATRLMSTVKPLRELAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKTTVTLTYGSSRPSIEIYRPPATRNTDSGAHLNRLQFQQQQNSIHAAKQLDIQSSRVYETGRLCEPEVLNSLEETYSPFFRSNAEKMSIEEENFRKRKLPVVSSVVKVKKFSHDGEEEEEDDDCGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVSQKQTLPVAPRTRTSQEDLLAEVAQGHGRVPRISSPVKEEEAQGGSVDERQGTQQRQLLSRLQIDPVMAETLQISQDYYDMESMVHADTRSFILKKPKLCEELVVAASQASGMETADALQARSGHLVQTRDLVQPDKPAsPKFIVTLDGVPS---PPGYMSDQEEDMCSEGMRPAQHPAASHGGLAGLLH-----PQRSRVLSRQLED----PDGSFANAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPVSPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHMSRRTPGLPPKPVT-APAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCAFYHPTITVPPRHALKWIRPQTSD
  :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::**::::::::::::::::::::.:::::::::::::::::::::.:::::::::::::::::...:...:::::::::::::::::::::::::.::.::.:::.:::::::.:.:.::::.:::::::::::::::::::::::::   ::::::::::.::.:::.::.:..::..:::::::     :::..::::::::    :....:.***::**************************:****:*************************:****:******:***:::*:***.:::***:*::*:*******************************:******:*************:*:
Consensus MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVSSVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMAETLQMSQDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPS---PPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGLLH-----PQQLHLLSRQLED----PNGSFSNAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.